ELISA Recombinant Thermotoga petrophila Prolipoprotein diacylglyceryl transferase(lgt)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) Uniprot NO.:A5IKR3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKILAFLSIAAGSTLFFVFLFIFLSKVFSGEILLSRYIFRIGGFELRWYSTLILTGFLI SYFVARKRAKNEGINLEEFDELIFYGVIAGIVGARLYYVLFNLKYYRSLWDALKIWEGGL AIHGAVIGALLTGFLYVRLKKPSFTFLQATDLFTSVLPLGQAIGRWGNFFNYEAFGVPTN LPWKMFVPEPYRPVVYKDYSFFHPTFLYESIWDLLVFFmLSVYFKRYRKRHGEVTCLYFV LYSLGRIVIERLRVDSLMIGNIKAAQLLSAVLILLGFTGFLILRSSQEPKRAF Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.- Gene Names:Name:lgt Ordered Locus Names:Tpet_0767 Expression Region:1-293 Sequence Info:fµLl length protein