ELISA Recombinant Synechococcus sp. Apocytochrome f(petA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain WH7803) Uniprot NO.:A5GMW2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YPFWAQQNYDSPREATGKIVCANCHLAQKLTQAEVPQSVLPDSVFKAVVKIPYDTSVPEI GADGSEVPLQVGAVVmLPDGFTLAPQDRWTDDIKEETEGVYFSEYSDDQPNVILVGPIPG DQHQEIVFPVLSPDPATDSNIHFGKYSIHVGGNRGRGQVYPTGEKSNNTVFTAPSTGTVR SIEAGENGASVVTIASADGTELSETVPVGPALIVSVGDAVEAGAPITNDPNVGGFGQLDT EVVLQNPVRIYGLLAFFAAVALAQImLVLKKKQFEKVQAAEGV Protein Names:Recommended name: Apocytochrome f Gene Names:Name:petA Ordered Locus Names:SynWH7803_1851 Expression Region:28-310 Sequence Info:fµLl length protein