ELISA Recombinant Synechococcus sp. Apocytochrome f(petA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain RCC307) Uniprot NO.:A5GRU7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YPFWAQQNYDSPREATGKIVCANCHLAKKLTQVEVPQSVMPDTVFKAVVKVPYDTDVQQV GADGNRTALNVGAVVmLPDGYTLAPQDRLSDELKEETEGIYYTQYSDDQPNILLVGPLPG DEHQELVFPILAPDPKTDSSISYGKTQIHVGGNRGRGQVYPTGEKSNNTVYTASVAGDIT AITGGDAGASVVTIAGDDGNVEETIPAGPALVVAVGDSVDAGEALTDDPNVGGFGQMDAE VVLQNPVRLYGLLGFLAAVAIAQImLVLKKKQIEKVQAAEGV Protein Names:Recommended name: Apocytochrome f Gene Names:Name:petA Ordered Locus Names:SynRCC307_0703 Expression Region:28-309 Sequence Info:fµLl length protein