ELISA Recombinant Sphingomonas wittichii UPF0060 membrane protein Swit_0423 (Swit_0423)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) Uniprot NO.:A5V3C5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPGAGLFIFVAAALCEIGGCFAFWAWLRLGKSPLWAVGGVGLLILFAWLLTRVDSAAAGR AFAAYGGIYICASLGWMWAVEGGRPDRWDLIGVLLCAVGSAVILLGPRTA Protein Names:Recommended name: UPF0060 membrane protein Swit_0423 Gene Names:Ordered Locus Names:Swit_0423 Expression Region:1-110 Sequence Info:fµLl length protein