Skip to Content

ELISA Recombinant Pseudomonas putida UPF0114 protein Pput_0713 (Pput_0713)

https://www.anagnostics.com/web/image/product.template/151207/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas putida (strain F1 / ATCC 700007) Uniprot NO.:A5VYB7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEVVHVLPNVFALSEADLILVILSL IDMSLVGGLLVMVMISGYENFVSQLDIDESKEKLNWLGKMDSSSLKMKVAASIVAISSIH LLRVFMDAQNISTDYLMWYVIIHMTFVVSAFCMGYLDKLTKH Protein Names:Recommended name: UPF0114 protein Pput_0713 Gene Names:Ordered Locus Names:Pput_0713 Expression Region:1-162 Sequence Info:fµLl length protein

1,506.00 € 1506.0 EUR 1,506.00 €

1,506.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.