ELISA Recombinant Pseudomonas putida Probable intracellular septation protein A (Pput_1411)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas putida (strain F1 / ATCC 700007) Uniprot NO.:A5W0A9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQFIDFIPLLLFFIVYKLDPRPMEVAGHHFEFGGIYSATAmLIISSLVVYGALFLRQRK LEKGQWLTLIACLVFGGLTLTFHSETFLKWKAPVVNWLFALGFAGSHFIGDRVLIKRIMG HALTLPDAIWTRLNLAWIAFFLFCGAANLFVAFTFQDFWVDFKVFGSLGMTVIFLVAQGV YLSRHLHDDPSTSKPKD Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:Pput_1411 Expression Region:1-197 Sequence Info:fµLl length protein