ELISA Recombinant Psychrobacter sp. Protease HtpX(htpX)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Psychrobacter sp. (strain PRwf-1) Uniprot NO.:A5WHL4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMRIGLFLLTNLAVLVVFSIVFGILSSVFGLGSVHGAGGLNIASLAVMCAVYGMIGSMIS LFLSKWMAKRSTGTVVIEQPRNASEQWLVETVAKQAKAVNIDMPEVGIFDNAQPNAFATG WNKNKALVAVSSGLLHTMTPDEVEAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARIV GSFVDRVVFKNEDGPGIGYFVTSIVMDILLGFLASAIVMWFSRQREFRADAMGAKLAGRD KMISALNALRPAEARPDQMPENMQAFAISSGQTQGFSIANFFRSHPTLDDRIEALKKYTP GQS Protein Names:Recommended name: Protease HtpX EC= 3.4.24.- Alternative name(s): Heat shock protein HtpX Gene Names:Name:htpX Ordered Locus Names:PsycPRwf_2215 Expression Region:1-303 Sequence Info:fµLl length protein