ELISA Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE(rnfE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain PA7) Uniprot NO.:A6V1T4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEQGLREIARDGLWRNNPGLVQLLGLCPLLGTSNSTVNALGLGLATLLVLVCSNAAVSL VRGAVSEAIRLPAFVMIIAALTTCIELLMQAWTYELYQILGIFIPLITTNCVILGRAEAF AAKNGVLRASFDGLLTGLGFALVLLVLGGLRELLGQGTLLADMQLLFGPAAETWKIQIFP HYQGFLLAILPPGAFImLGLLIALKNRIDESLAERARAQAGDVPASPQRQRVRVTGVIE Protein Names:Recommended name: Electron transport complex protein RnfE Gene Names:Name:rnfE Ordered Locus Names:PSPA7_1635 Expression Region:1-239 Sequence Info:fµLl length protein