ELISA Recombinant Saccharomyces cerevisiae Protein ROT1(ROT1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast) Uniprot NO.:A6ZMR2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:EDESNSIYGTWSSKSNQVFTGPGFYDPVDELLIEPSLPGLSYSFTEDGWYEEATYQVSGN PRNPTCPMASLIYQHGTYNISENGTLVLNPIEVDGRQLFSDPCNDDGVSTYSRYNQTETF KEYAVGIDPYHGIYTLQLYQYDGTPMQPLYLAYRPPMmLPTETLNPTSSATSTDDSSSNK KRSLRSLVRRSLENRHKTNAIKRQNTSFLTSNAIWYISAGmLGVGSLLFLAF Protein Names:Recommended name: Protein ROT1 Alternative name(s): Reversal of TOR2 lethality protein 1 Gene Names:Name:ROT1 ORF Names:SCY_4378 Expression Region:25-256 Sequence Info:fµLl length protein