ELISA Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP18(TVP18)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast) Uniprot NO.:A6ZMD0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREmL Protein Names:Recommended name: Golgi apparatus membrane protein TVP18 Alternative name(s): TLG2 compartment vesicle protein of 18 kDa Gene Names:Name:TVP18 ORF Names:SCY_4242 Expression Region:1-167 Sequence Info:fµLl length protein