ELISA Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast) Uniprot NO.:A6ZR50 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIEEKKERKKRRVLQMARFYGAAAFTLITMRLISRAIKVRKYVPSIFQQNYKLPPFSQRN EAMSALTYASAASIGTFSTLIFGFCWALDISTAREFVFKTREFMGVPQALETDTSMDEET SKLTKQLQDLLSSENNK Protein Names:Recommended name: Altered inheritance of mitochondria protein 11 Alternative name(s): Genetic interactor of prohibitins 8 Gene Names:Name:AIM11 Synonyms:GEP8 ORF Names:SCY_1597 Expression Region:1-137 Sequence Info:fµLl length protein