Skip to Content

ELISA Recombinant Sclerotinia sclerotiorum Golgi apparatus membrane protein tvp18(tvp18)

https://www.anagnostics.com/web/image/product.template/156613/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum) Uniprot NO.:A7EMV1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTIAEEFATRNFSIYGQWTGVVCILLCFALGIANLFHVSLLIIFSALCLVSSFLIIFIEI PLLLRICPTSSTFDTFMRRFTTNYMRAAIYMGMAIVQWLSIIIAASSLIAAAVLLTIAAG FYALAGLKGQGFVGSKTLGGQGVAQMIL Protein Names:Recommended name: Golgi apparatus membrane protein tvp18 Gene Names:Name:tvp18 ORF Names:SS1G_06650 Expression Region:1-148 Sequence Info:fµLl length protein

1,491.00 € 1491.0 EUR 1,491.00 €

1,491.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.