ELISA Recombinant Sclerotinia sclerotiorum Solute carrier family 25 member 38 homolog (SS1G_14414)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum) Uniprot NO.:A7F9Y3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNGGNAGKKSSSYFHFTAGLGSGILSAVLLQPADLLKTRLQQSNHASLLTTIRELSQSP NTIRSFWRGTVPSALRTGFGSAIYFTSLNALRQNVARSNLLRTIGVVDAKNGPVHSSSLP KLSNLANLTTGAVARAGAGFVLMPMTIIKVRYESNLYAYKSIMGAGRDIFLTEGFRGFFS GFGATAIRDAPYAGLYVLFYEQLKKRLSHIVHSVPQAEELVENLGVRKNMKGSTSASINF GSGVLAAGLATAITNPFDAIKTRIQLQPKKYTNLVMAGRKMVGEEGVKSLFDGLGLRMGR KAVSSALAWTIYEELIRRAELAWKGEEVIV Protein Names:Recommended name: Solute carrier family 25 member 38 homolog Gene Names:ORF Names:SS1G_14414 Expression Region:1-330 Sequence Info:fµLl length protein