ELISA Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial(GEP7)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast) Uniprot NO.:A6ZUB9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AVAGNLLVKRFYQPKLERIPPASLLLKQKIRLAQNGSTTSTENPISFSQTMSEIFSVLQP SAPDLDEDKTSGLKRDHLLTERLNNGELGVIMNKFFNPSSTHNNQLIDTNILLQNFPKLS GNDLDLLDFAINEKMRGNWNDLKQDFIQLWYYKSFGFLGPRTQFVLTNSSPSLRSQFLKL PFTEYNWFLLQNNKNANILPADVQNVVKVFHLDDKRFTWKSIDPFSKAIISFVVFVSIYV WLDESAKQKTKELPAQKSTVISE Protein Names:Recommended name: Genetic interactor of prohibitin 7, mitochondrial Gene Names:Name:GEP7 ORF Names:SCY_2002 Expression Region:25-287 Sequence Info:fµLl length protein