ELISA Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP38(TVP38)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast) Uniprot NO.:A7A047 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQSYEAGNANMGQGEDDEFDGYFEDFDNDIMPNSNNGQRVGTNAGLSFNDEVNVNDDDF LDIYNMSPRERLMHNIRKNVQKLQFYFYSLRLWQQIIIVLLGImLMIMGILLLVFHNAIL HKVVVTSNDLREKMSTHFILMVLIFFVAFPPMIGYSLLSTTTGLIYGVSFEGWVTLALGS VTGSIASFVVFKTILHSRAEKLVHLNRRFEALASILQENNSYWILALLRLCPFPYSLTNG AIAGVYGISVRNFSIANIITTPKLFIYLFIGSRVKSLAESESTGSRVFDLVSIIITLLIL SLTAWLLYFKTKKRYLELQNRDRQVSTDQLPELSFEV Protein Names:Recommended name: Golgi apparatus membrane protein TVP38 Alternative name(s): TLG2-vesicle protein of 38 kDa Gene Names:Name:TVP38 ORF Names:SCY_3457 Expression Region:1-337 Sequence Info:fµLl length protein