ELISA Recombinant Sclerotinia sclerotiorum 3-ketoacyl-CoA reductase (SS1G_14012)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum) Uniprot NO.:A7F8T1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MILDTILSHVPKVVLTGLAGIGAFIVAGKVISYIRLLLSLFVLSGKNLRTYGKKGTWAVV TGASDGLGKEYAIQLAQKGFNIVLISRTESKLQTLASEIQTKYAGSNIQTKILAMDFAAN RDEDYAKLKALVDGLDVGILVNNVGQSHSIPVPFIQTPKEEMRDIITINCIGTLRVTQIV APGMVQRKRGLILTMGSFGGWLPTPLLATYSGSKAFLQQWSTSLGGELEGTGVDVELVLS YLVTTAMSKIRRTSLFIPNPRTFVKTTLAKVGRSGGAQKIAYTSTPFWGHALMQWWLENT LGVGGSFVVNQNKVMHQSIRARALKKAERDAKKA Protein Names:Recommended name: 3-ketoacyl-CoA reductase Short name= 3-ketoreductase Short name= KAR EC= 1.1.1.- Alternative name(s): Microsomal beta-keto-reductase Gene Names:ORF Names:SS1G_14012 Expression Region:1-334 Sequence Info:fµLl length protein