ELISA Recombinant Staphylococcus aureus Accessory gene regulator protein B(agrB)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain JH1)
Uniprot NO.:A6U3C2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL VTHLSYmLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFmLLGILVESITLLP IFFPKED
Protein Names:Recommended name: Accessory gene regµLator protein B EC= 3.4.-.-
Gene Names:Name:agrB Ordered Locus Names:SaurJH1_2110
Expression Region:1-187
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.