ELISA Recombinant Sinorhizobium medicae UPF0314 protein Smed_3089 (Smed_3089)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sinorhizobium medicae (strain WSM419) (Ensifer medicae) Uniprot NO.:A6UE35 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTIAAGSDDNRQRRAALLLLACLAVLALQILVLHLMGRLWICECGYIKLWEGVAKSSGNS QHVSDWYTPSHIIHGFLFYGLGHLLMRGKPLSGRLLLATVIESAWEILENTPMVINRYRS ATISLDYFGDSILNSTMDTLAMATGFLIASRLPVAVTVAIAIALELFTGFMVRDNLTLNV LmLVWPMDAVKAWQAG Protein Names:Recommended name: UPF0314 protein Smed_3089 Gene Names:Ordered Locus Names:Smed_3089 Expression Region:1-196 Sequence Info:fµLl length protein