ELISA Recombinant Sinorhizobium medicae ATP synthase subunit b-b'(atpG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sinorhizobium medicae (strain WSM419) (Ensifer medicae) Uniprot NO.:A6U6M6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFVTAAYAQSTTTEGAEAHDAAAAGEVHTETGVAHEGEHGSGVFPPFDSTHFASQLLWLA ITFGLFYLLMSKVIIPRIGSILETRHDRIAQDLDEASRLKGEADAAIAAYEQELAGARAK GHSIADTAREAAKSKAKADRDGVEADLAKKIAAAEARIGDIKSKALADVGAIAEETATAI VKQLIGGTVTKSEIAAAFKASAGN Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b' Gene Names:Name:atpG Ordered Locus Names:Smed_0449 Expression Region:1-204 Sequence Info:fµLl length protein