ELISA Recombinant Sclerotinia sclerotiorum Probable endonuclease lcl3(lcl3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum) Uniprot NO.:A7ECE0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGWLDFNSNSKKEKGKDDARSSFSWGDNLNATDWQHYTDPRTLIPTLLLTTTILFSTRLY RSYLRRIPEATHIRPGFFRKRSLFGTVTRVGDADNFHLFHTPGGRLAGWGWLPGRKTLPE GKDLKNKTIHVRIAGVDAPEGAHFGKPAQPFSAEALAWLRDYIQNRRVRAYIYRRDQYNR VVATVWVRRFLFRKDVGKEmLKAGMATVYEAKMGAEFGDFEAQYRAIEKEAKKNKLGMWS GKKKDYESPRDYKTRTAAAANILK Protein Names:Recommended name: Probable endonuclease lcl3 EC= 3.1.-.- Gene Names:Name:lcl3 ORF Names:SS1G_02979 Expression Region:1-264 Sequence Info:fµLl length protein