ELISA Recombinant Xanthobacter autotrophicus Cobalamin synthase(cobS)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) Uniprot NO.:A7IB66 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQLDRIAQDLVAALRFYSRLPLPAGRDDPDAFAVPSLNRIAYAIPLAGAVIGLIGAVVLV GALALKLPAFLASVLAVTALVLTTGAFHEDGLADTADGLGGGRDKAQRLAIMRDSRIGTY GGCALILALLLRVAALEALVASAGMFRAALALVVAEAASRAAGVLLLLALPPARADGAGA SFGRPSESAGLACALVAALLVVVILVPGFGISTAFAGLIAPLVALFAMMRLSGRLIGGQT GDVAGATQQVAVIVFLLGVLIFPGR Protein Names:Recommended name: Cobalamin synthase EC= 2.-.-.- Gene Names:Name:cobS Ordered Locus Names:Xaut_4260 Expression Region:1-265 Sequence Info:fµLl length protein