ELISA Recombinant Vitis vinifera CASP-like protein VIT_05s0020g01830 (VIT_05s0020g01830)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Vitis vinifera (Grape)
Uniprot NO.:A7NW79
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSVDTEKPAPPPLETEAPPPPPPPPPPPPPPPPPPAGYSALDVVLRILLLGSAVASVVV MVTSVQTKLIAVAGVPVLVSNKAKFQNSPAFIYFVAALSVVGLYSIITTLASFIFISKPS CSTKTILHLAIWDVLmLGLAASATGTAGGVAYVGLKGNSHVGWNKVCNTYDKFCRHVGGS IAVALFASILLVLLVWLSLFTLYSRIRK
Protein Names:Recommended name: CASP-like protein VIT_05s0020g01830
Gene Names:Ordered Locus Names:VIT_05s0020g01830 ORF Names:GSVIVT00019814001, GSVIVT01017796001, VIT_00017796001, Vv05s0020g01830
Expression Region:1-208
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.