ELISA Recombinant Vitis vinifera Casparian strip membrane protein VIT_14s0108g01050 (VIT_14s0108g01050)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Vitis vinifera (Grape)
Uniprot NO.:A7PMY7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKAGALELGEGSKTSIPRGGVNRGISILDFILRLITIIGTLGSAIAMGTTNETLPFFTQF TQFRAEYDDLPTFTFFVIANSIVSGYLVLSLPMSILHIVRSGARASRIVLIFFDTAmLAL LTAAASAASAIVYLAHKGNAQANWFAICQQFKSFCERISGSLIGSFGGIILFILLVLLSA VALSRC
Protein Names:Recommended name: Casparian strip membrane protein VIT_14s0108g01050
Gene Names:Ordered Locus Names:VIT_14s0108g01050 ORF Names:GSVIVT00020996001, GSVIVT01011443001, VIT_00011443001, Vv14s0108g01050
Expression Region:1-186
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.