ELISA Recombinant Vitis vinifera Casparian strip membrane protein VIT_14s0108g01050 (VIT_14s0108g01050)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7PMY7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKAGALELGEGSKTSIPRGGVNRGISILDFILRLITIIGTLGSAIAMGTTNETLPFFTQF TQFRAEYDDLPTFTFFVIANSIVSGYLVLSLPMSILHIVRSGARASRIVLIFFDTAmLAL LTAAASAASAIVYLAHKGNAQANWFAICQQFKSFCERISGSLIGSFGGIILFILLVLLSA VALSRC Protein Names:Recommended name: Casparian strip membrane protein VIT_14s0108g01050 Gene Names:Ordered Locus Names:VIT_14s0108g01050 ORF Names:GSVIVT00020996001, GSVIVT01011443001, VIT_00011443001, Vv14s0108g01050 Expression Region:1-186 Sequence Info:fµLl length protein