ELISA Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 36, mitochondrial(AIM36)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A7TIN0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SAGSSSSNNEIPGFGKIALVGVIGTYIFYKAAQSIDRNKPKEYVSEDEYNNVMSGLKRRV SIFKPDEVEIHLSPIKDVTKVKRLFRDDKQMIYIDPAKLAEQVRQDPEDPYEPLLEELVK KHGTEAYYDHLPFGMAAmLTGRYMKENCKAGDRIVVYNFPLNIQEAIKFENEISILKDIV VYKDDQSIDGVVSYYKTVKKVQEI Protein Names:Recommended name: Altered inheritance of mitochondria protein 36, mitochondrial Alternative name(s): Found in mitochondria protein 39 Gene Names:Name:AIM36 Synonyms:FMP39 ORF Names:Kpol_1043p12 Expression Region:40-243 Sequence Info:fµLl length protein