ELISA Recombinant Yersinia pseudotuberculosis serotype O:1b UPF0208 membrane protein YpsIP31758_1444 (YpsIP31758_1444)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pseudotubercµLosis serotype O:1b (strain IP 31758) Uniprot NO.:A7FGP5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLSEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL Protein Names:Recommended name: UPF0208 membrane protein YpsIP31758_1444 Gene Names:Ordered Locus Names:YpsIP31758_1444 Expression Region:1-151 Sequence Info:fµLl length protein