ELISA Recombinant Vitis vinifera Casparian strip membrane protein VIT_06s0080g00840 (VIT_06s0080g00840)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7QF77 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKSTGEATAINIGETKSASATTVATTKAIQHPKAGLKRGLAIFDFILRLSAIGAALAATT TMGTTDQTLPFFTQFFQFQASYDDLPAFSFFVIANAIASGYLFLSLPFSIVCIVRPHAMG ARLLLVICDTVMVALTIAAAAAAAAIVYLAHNGNSNANWVAICQQFDDFCQSVSGAVVAS FIAAVLFmLMIVLSAFSLRKH Protein Names:Recommended name: Casparian strip membrane protein VIT_06s0080g00840 Gene Names:Ordered Locus Names:VIT_06s0080g00840 ORF Names:GSVIVT00037312001, GSVIVT01036085001, VIT_00036085001, Vv06s0080g00840 Expression Region:1-201 Sequence Info:fµLl length protein