ELISA Recombinant Vitis vinifera Casparian strip membrane protein VIT_06s0080g00840 (VIT_06s0080g00840)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Vitis vinifera (Grape)
Uniprot NO.:A7QF77
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKSTGEATAINIGETKSASATTVATTKAIQHPKAGLKRGLAIFDFILRLSAIGAALAATT TMGTTDQTLPFFTQFFQFQASYDDLPAFSFFVIANAIASGYLFLSLPFSIVCIVRPHAMG ARLLLVICDTVMVALTIAAAAAAAAIVYLAHNGNSNANWVAICQQFDDFCQSVSGAVVAS FIAAVLFmLMIVLSAFSLRKH
Protein Names:Recommended name: Casparian strip membrane protein VIT_06s0080g00840
Gene Names:Ordered Locus Names:VIT_06s0080g00840 ORF Names:GSVIVT00037312001, GSVIVT01036085001, VIT_00036085001, Vv06s0080g00840
Expression Region:1-201
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.