ELISA Recombinant Vanderwaltozyma polyspora Solute carrier family 25 member 38 homolog (Kpol_1043p32)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A7TIQ0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANTTKTRTHLIGGFFGGLTSAVALQPLDLLKTRIQQHQSQSIWSIVKNSKGFSELWRGT LPSAIRTSLGSALYLSSLNLMRTAIAKSKTNYNDGASKSSLLPKLTTYENLISGALARGA VGYMTMPVTVIKVRYESTLYSYTSLSQAVKHIYQSERIPGFFRGFGPTLVRDAPYSGIYV LLYEKAKEVVPKLLPRKFIKFDKHGSYLTSTSTLVNSTSAILSACLATTITAPFDTIKTR MQLEPKRYTNVWFTFKSIIKNEGILKLFSGLSMRLTRKALSAGIAWGIYEELIKLNKF Protein Names:Recommended name: Solute carrier family 25 member 38 homolog Gene Names:ORF Names:Kpol_1043p32 Expression Region:1-298 Sequence Info:fµLl length protein