ELISA Recombinant Vitis vinifera CASP-like protein VIT_05s0020g01820 (VIT_05s0020g01820)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7NW78 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEVESKTSFGGMESKSKEVKVVTGGKLRPFDLVLRVVALALTLVAAVLLGVDKQTKVVSL QLLPTLPPMDVPVTAKWRYLSAFVYFVVSNAIACSYAALSLLLSVGNSKGNKGLGLAITV MDLVMVALLFSSNGAAGAIGLMGYEGNSRVRWGKVCNVFGKFCNQVAVALGLSFFGGLAF FLLVVMAAFALNKRH Protein Names:Recommended name: CASP-like protein VIT_05s0020g01820 Gene Names:Ordered Locus Names:VIT_05s0020g01820 ORF Names:GSVIVT00019813001, GSVIVT01017795001, VIT_00017795001, Vv05s0020g01820 Expression Region:1-195 Sequence Info:fµLl length protein