ELISA Recombinant Vitis vinifera CASP-like protein VIT_12s0028g03760 (VIT_12s0028g03760)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7PJ32 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAKNTDRICFLVLRLLAFGATLSAAIVMATSHERTTYLSLSIEAKYSHTPAFKYFVIANA IGSAYSLLLLFLPSHGSLWPLVIASDVVITMFLTSSISAALSIAYVGKKGNSYAGWLPIC DQVPNYCNHVTGALAAGFIGVVLYMVLLQYSIYTKCCKSSS Protein Names:Recommended name: CASP-like protein VIT_12s0028g03760 Gene Names:Ordered Locus Names:VIT_12s0028g03760 ORF Names:GSVIVT00018576001, GSVIVT01020544001, VIT_00020544001, Vv12s0028g03760 Expression Region:1-161 Sequence Info:fµLl length protein