ELISA Recombinant Vitis vinifera CASP-like protein VIT_12s0028g03760 (VIT_12s0028g03760)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vitis vinifera (Grape)
Uniprot NO.:A7PJ32
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKNTDRICFLVLRLLAFGATLSAAIVMATSHERTTYLSLSIEAKYSHTPAFKYFVIANA IGSAYSLLLLFLPSHGSLWPLVIASDVVITMFLTSSISAALSIAYVGKKGNSYAGWLPIC DQVPNYCNHVTGALAAGFIGVVLYMVLLQYSIYTKCCKSSS
Protein Names:Recommended name: CASP-like protein VIT_12s0028g03760
Gene Names:Ordered Locus Names:VIT_12s0028g03760 ORF Names:GSVIVT00018576001, GSVIVT01020544001, VIT_00020544001, Vv12s0028g03760
Expression Region:1-161
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.