Skip to Content

ELISA Recombinant Vitis vinifera CASP-like protein VIT_01s0010g01870 (VIT_01s0010g01870)

https://www.anagnostics.com/web/image/product.template/160874/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7QBZ2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMGDKGEKECATASSPIELGCGEGDESGNKSSMRTVETLLRLVPVALCTVSLVVmLKNSQ TNDFGSLSYSDLGAFRYLVHANGICAGYSLLSAIFTAMPRPPTMSRAWTFFLLDQVLTYL ILAAGAVSTEVVYLAYKGDEAVTWSDACSSFGGFCQKTTASISITFVTVLCYAVLSLISS YKLFSKYDAPICFNGKGIEIAAFHS Protein Names:Recommended name: CASP-like protein VIT_01s0010g01870 Gene Names:Ordered Locus Names:VIT_01s0010g01870 ORF Names:GSVIVT00035166001, GSVIVT01010256001, VIT_00010256001, Vv01s0010g01870 Expression Region:1-205 Sequence Info:fµLl length protein

1,551.00 € 1551.0 EUR 1,551.00 €

1,551.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.