ELISA Recombinant Vibrio harveyi Fumarate reductase subunit D(frdD)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120) Uniprot NO.:A7MZ44 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKPNYSVNTAPKRSDEPIWWGLFGAGGTWFAMITPITVLVLGILVPLGVIDAEAMSYERV SEFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVVGKIACYAFAGLISALAVV FIFMI Protein Names:Recommended name: Fumarate reductase subunit D Gene Names:Name:frdD Ordered Locus Names:VIBHAR_00134 Expression Region:1-125 Sequence Info:fµLl length protein