ELISA Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 39, mitochondrial(AIM39)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A7TP86 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SNDSKYFFSKPPANDNNDKGSYADSKHFFTKPNGKMNSNEQIDQMHNNGSNNPNNNKNGS TDSLIGQAILQQRRERRKQVWYALGISIFAVLIGYSIGYKVIYLNEDSFIPLYPSSGIRK PSQNDLRKIDVPHIKLISHLRVLEVLSHHDMIKEQYGVPLHDSNGVNPPQIKEFNIWCED QDPCVTGLIIRKDDPNRPTTHTWHRIPYLLQWRVTHRPICISRSISNFLEDIGLSYSTIY EIISPEKIYGSFKYEYPIPGDDHSMHIWFLGELQLNNDTLIIYKGKYHVDVKLQQVDLLR NEDGKLVRYVLFKENE Protein Names:Recommended name: Altered inheritance of mitochondria protein 39, mitochondrial Gene Names:Name:AIM39 ORF Names:Kpol_480p24 Expression Region:30-345 Sequence Info:fµLl length protein