ELISA Recombinant Xanthobacter autotrophicus ATP synthase subunit b 2(atpF2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) Uniprot NO.:A7IGS8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVAQAAPPAGTAGQGTHEAASAAHGAAAAHGAAEEGHGKKSHFPPFDATTFASQLLWLVL SFGLLYLLMSRVALPRIGRILEERHDRIADDLEEAAKHKAESEAAQASYEKALAEARAKA NAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKTEALTHVRGIAVDATHAIV STLIGSSPAQSDVEKAVDVALVKKDAA Protein Names:Recommended name: ATP synthase subunit b 2 Alternative name(s): ATP synthase F(0) sector subunit b 2 ATPase subunit I 2 F-type ATPase subunit b 2 Short name= F-ATPase subunit b 2 Gene Names:Name:atpF2 Ordered Locus Names:Xaut_1977 Expression Region:1-207 Sequence Info:fµLl length protein