ELISA Recombinant Vitis vinifera CASP-like protein VIT_19s0090g00570 (VIT_19s0090g00570)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Vitis vinifera (Grape)
Uniprot NO.:A7P0P3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNLAETAPISSAHIPTLKLIDCSLRLCVIPLSVATIWLTVTNQQDNSIYGKLEFSNLTG LKYMVCISGISAGYALVAVVASWVRCLVNKAWLFFVSDQIMAYLMVTSGAAVLEILYLAY KGDRGVSWSEACSSYGRFCSRVNLALALHALALCCFLVLAVISAYRVFSMFEPPVSSKEV EEERAS
Protein Names:Recommended name: CASP-like protein VIT_19s0090g00570
Gene Names:Ordered Locus Names:VIT_19s0090g00570 ORF Names:GSVIVT00027310001, GSVIVT01037665001, VIT_00037665001, VITISV_007688, Vv19s0090g00570
Expression Region:1-186
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.