ELISA Recombinant Vitis vinifera CASP-like protein VIT_19s0090g00570 (VIT_19s0090g00570)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7P0P3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNLAETAPISSAHIPTLKLIDCSLRLCVIPLSVATIWLTVTNQQDNSIYGKLEFSNLTG LKYMVCISGISAGYALVAVVASWVRCLVNKAWLFFVSDQIMAYLMVTSGAAVLEILYLAY KGDRGVSWSEACSSYGRFCSRVNLALALHALALCCFLVLAVISAYRVFSMFEPPVSSKEV EEERAS Protein Names:Recommended name: CASP-like protein VIT_19s0090g00570 Gene Names:Ordered Locus Names:VIT_19s0090g00570 ORF Names:GSVIVT00027310001, GSVIVT01037665001, VIT_00037665001, VITISV_007688, Vv19s0090g00570 Expression Region:1-186 Sequence Info:fµLl length protein