ELISA Recombinant Vitis vinifera Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7PP95 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSGANATTIDVPETRAEAKGKAPLIAAPIVATTKATPHPNAGWKKGLAIFDFLLRLAAI AATLAAATTMGTTDETLPFFTQFFQFQASFDDLPAFMFFVVATAIASGYLALSLPFSLVS IFRPHAQGIRLLLIISDTVmLALTTAGAASATAIVYLAHNGDSSANWIAICQQFTDFCQS VSGAVVASFIAVVIFmLLVMMSALALRKH Protein Names:Recommended name: Casparian strip membrane protein VIT_08s0007g02880 Gene Names:Ordered Locus Names:VIT_08s0007g02880 ORF Names:GSVIVT00021563001, GSVIVT01033894001, VIT_00033894001, Vv08s0007g02880 Expression Region:1-209 Sequence Info:fµLl length protein