ELISA Recombinant Vitis vinifera CASP-like protein VIT_11s0052g01140 (VIT_11s0052g01140)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Vitis vinifera (Grape)
Uniprot NO.:A7Q6G6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVLGVGPRTVTPHLRKGMMESSSGISLARAEAFLRLFAILVLVLTACLLGFDTQTKLLF STIKKTATFRDLGALQVVVYVDSVAAGYNLLQLGRGFISAKLKGKLINVSYVTLPWVCFL LDQAAVYTVFSANTAALQASIIAVTGESSLQWMKVCNRYTRFCIQVGGALLSGYLASLLM VLLSSLSAFSLFRLYSPKQFHLLKPT
Protein Names:Recommended name: CASP-like protein VIT_11s0052g01140
Gene Names:Ordered Locus Names:VIT_11s0052g01140 ORF Names:GSVIVT00031388001, GSVIVT01029179001, VIT_00029179001, Vv11s0052g01140
Expression Region:1-206
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.