ELISA Recombinant Vitis vinifera CASP-like protein VIT_17s0000g00560 (VIT_17s0000g00560)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7PHN8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MCFQFSILYTCYLAHFGVFPRKYLVMAGIEAKFQQNPPLGTHKLFLGAHICLRILTVTAT LTAAWMMITSKQTVEVYGIQVEAKYSYSSAFKFFSYANAIACGCSVLTLFPAFSLFYRGS TPMKFFFLFLHDLCMMSLVLAGCAAATAIGYVGRYGNNHAGWMAICDQFDEYCNRIRLSL MFSYLAFVFILmLTIMSANKSREIRV Protein Names:Recommended name: CASP-like protein VIT_17s0000g00560 Gene Names:Ordered Locus Names:VIT_17s0000g00560 ORF Names:GSVIVT00018013001, GSVIVT01008618001, VIT_00008618001, Vv17s0000g00560 Expression Region:1-206 Sequence Info:fµLl length protein