ELISA Recombinant Vitis vinifera CASP-like protein VIT_07s0104g01350 (VIT_07s0104g01350)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Vitis vinifera (Grape)
Uniprot NO.:A7PTY8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MESQCRPNVDGVHNGVESHVKVVEKPRSVGSSSEFVLRILGLLLTLIAAVVAGVDKQTKI IPLTLIKTLPSLHVPVTAKWSDMSAFVYLVVSNAIACSYAAISLVLVTmLGRRGKGGRVL AVIVLDLHMVGLLFSANGAATAVGVLGQYGNSHVEWKKVCNVFDSFCHHLVASLALSFLG SLSFLGLVLLAILNLHKKSSTK
Protein Names:Recommended name: CASP-like protein VIT_07s0104g01350
Gene Names:Ordered Locus Names:VIT_07s0104g01350 ORF Names:GSVIVT00023588001, GSVIVT01010992001, VIT_00010992001, VITISV_023954, Vv07s0104g01350
Expression Region:1-202
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.