ELISA Recombinant Vitis vinifera CASP-like protein VIT_07s0104g01350 (VIT_07s0104g01350)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7PTY8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESQCRPNVDGVHNGVESHVKVVEKPRSVGSSSEFVLRILGLLLTLIAAVVAGVDKQTKI IPLTLIKTLPSLHVPVTAKWSDMSAFVYLVVSNAIACSYAAISLVLVTmLGRRGKGGRVL AVIVLDLHMVGLLFSANGAATAVGVLGQYGNSHVEWKKVCNVFDSFCHHLVASLALSFLG SLSFLGLVLLAILNLHKKSSTK Protein Names:Recommended name: CASP-like protein VIT_07s0104g01350 Gene Names:Ordered Locus Names:VIT_07s0104g01350 ORF Names:GSVIVT00023588001, GSVIVT01010992001, VIT_00010992001, VITISV_023954, Vv07s0104g01350 Expression Region:1-202 Sequence Info:fµLl length protein