ELISA Recombinant Vitis vinifera CASP-like protein VIT_10s0092g00220 (VIT_10s0092g00220)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7QC16 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASKGEEKPELVGSKQGIVSVTKAKHDQIVLVLRVVAFLATASATIVMGLNQETKTLLVG TIGTTPIRATLKAKFQHTPAFVFFVVANGLASVYNLVmLGVDVFGRKLDCKGLRLVIISI LDMVIVAVVAAGASSAAFMAELGKNGNSHAKWNKICDKFESFCHQGGGALIPSFIALLLL FLISAISIITLHNQKLTSPHATTP Protein Names:Recommended name: CASP-like protein VIT_10s0092g00220 Gene Names:Ordered Locus Names:VIT_10s0092g00220 ORF Names:GSVIVT00035198001, GSVIVT01037957001, VIT_00037957001, VITISV_004162, Vv10s0092g00220 Expression Region:1-204 Sequence Info:fµLl length protein