ELISA Recombinant Vanderwaltozyma polyspora Golgi apparatus membrane protein TVP23(TVP23)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A7TGB4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEQINNFYSTILKSSHPFLLSIHLGGKAVPLIFYVLGSLFMGFTAQFISVVLLLAFDFYI TKNISGRKLVQLRWWYDTTGKQSSSFTFESYKQFSPGPSINPIDSKLFWWSIYLTPIVWI VFGIMCILRLKLFYFLLVSVGICLTGINAYGFRSCDKWEPNANEDSNNSWFQLPTIPGLD NLNALSQVQSFFQSRSG Protein Names:Recommended name: Golgi apparatus membrane protein TVP23 Gene Names:Name:TVP23 ORF Names:Kpol_1055p39 Expression Region:1-197 Sequence Info:fµLl length protein