ELISA Recombinant Vibrio harveyi UPF0761 membrane protein VIBHAR_00593 (VIBHAR_00593)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120) Uniprot NO.:A7MTU7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNQLSESYKVRLSKLVPGSVAFFQYLLKRMTHDRVNVNAGYLAYITLLSIVPmLTVLLSI LSKFPVFENVGETLQGYIIDNFVPASGDAVRTALQEFVSNTGKMTAVGGAFLFVAALmLI SNIDKNLNYIWRVKDKRRPVFSFSMYWMVLTLGPILVGASIAVTSYVTSLKLIENETLTG AYNLFLRWLPLLLSFFAFMGLYFLVPNKKVYLSHGAIGAAIAAVLFELSKKGFAFYITQF PSYQLIYGALAAIPILFVWVYLCWLIVLIGAEVTAALGEREHWSDDLEMIHSTAELQLTD EGSESRDSANSTSQ Protein Names:Recommended name: UPF0761 membrane protein VIBHAR_00593 Gene Names:Ordered Locus Names:VIBHAR_00593 Expression Region:1-314 Sequence Info:fµLl length protein