ELISA Recombinant Vibrio harveyi Prolipoprotein diacylglyceryl transferase(lgt)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120) Uniprot NO.:A7MXL0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQGYLEFPNIDPVLVSIGPVSVRWYGLMYLVGFMFALWLANRRADKPGSGWTREQVSDL LFAGFLGVVIGGRVGYVIFYNFDLFLADPLYLFKVWTGGMSFHGGLLGVITAMFWYAHKN GRTFFGVADFVAPLVPFGLGMGRMGNFMNSELWGRVTDVPWAIIFPNGGPLPRHPSQLYE MFLEGIVLFFILNWFIKKPRPLGAVSGLFLAGYGTFRFLVEFVREPDAQLGLFGGYISMG QILSSPMIILGILMMVWAYKRGLYQDKVQAETK Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.- Gene Names:Name:lgt Ordered Locus Names:VIBHAR_00970 Expression Region:1-273 Sequence Info:fµLl length protein