ELISA Recombinant Vibrio harveyi ATP synthase subunit a 1(atpB1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120) Uniprot NO.:A7N0Y8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAPGEALTSSGYIAHHLSNLSLAKLGLVADEASFWNVHIDSLFFSWFTGLIFLGIFYKV AKRTTAGVPGKLQCAVEMIVEFVAENVKDTFHGRNPLIAPLALTIFCWVFLMNVMDLVPI DFLPYPAEHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSIKVKGLGGFAKELALHPF NHPLMIPFNLLIEVVSLLAKPLSLGMRLFGNMFAGEVVFILCAAmLPWYLQWMGSLPWAI FHILVITIQAFVFMmLTIVYLSMAHEDSDH Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1 Gene Names:Name:atpB1 Ordered Locus Names:VIBHAR_00428 Expression Region:1-270 Sequence Info:fµLl length protein