ELISA Recombinant Vitis vinifera CASP-like protein VIT_14s0068g01400 (VIT_14s0068g01400)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitis vinifera (Grape) Uniprot NO.:A7PA04 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESLEVANGKSSALGVSREASSPPQMGFFIAQVVLRFFTLAFTGAAIAVMVTAKETVEVF SISFTVRYSYLSAFKFLVGADAVVCGFSmLSLIFVSIFNKGKSNHYFFLYFHDLILMVLS MSACAAATAVGYVGRYGQDKAAWMAVCGNVKMFCDKALASILLSLIGFICLFLLTIMAAR NLRVSGHLI Protein Names:Recommended name: CASP-like protein VIT_14s0068g01400 Gene Names:Ordered Locus Names:VIT_14s0068g01400 ORF Names:GSVIVT00037922001, GSVIVT01033020001, VIT_00033020001, VITISV_043317, Vv14s0068g01400 Expression Region:1-189 Sequence Info:fµLl length protein