ELISA Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 2-A(MCR1A)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A7THS1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFARIARINPKILPFVIGAPTIALCSYYYSSGAFLRNESSKVFIGDNNWIDLPISRIEEI SHDTKRFTFKYPSQDSVSGLVVASALLTKFVTPKGSNVIRPYTPVSDVDEKGSLDLVIKH YPDGKMTNHIFSLKVNDTLSFKGPIPKWKWVPNSFESITLIGGGTGITPLYQLIHAITKN PNDKTKIRLFYSNKTSQDVLMKKELDELQAKYPDQLRITYFITTPDKGYKGESGFISKEF IASNADKPSPKSHVFVCGPPPFMNAYSGDKKSPTDQGELVGILKELGYTIDQVYKF Protein Names:Recommended name: NADH-cytochrome b5 reductase 2-A EC= 1.6.2.2 Alternative name(s): Mitochondrial cytochrome b reductase A Gene Names:Name:MCR1A ORF Names:Kpol_543p67 Expression Region:1-296 Sequence Info:fµLl length protein