ELISA Recombinant Streptococcus gordonii UPF0397 protein SGO_0469 (SGO_0469)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288)
Uniprot NO.:A8AVH5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKIFDTTFTIKEVVATGIGAALFVVIGMVSIPTPVPNTSIQLQYAVQALFGVVFGPIVG FLTGFIGHALKDSIQYGNPWWTWVLASGLFGLVVGLLKNYLRVAQGVFESRDIITFNVAQ FVANALVWVVIAPLGDILIYNEPSNKVFAQGVVATVANGLTVAVAGTLLLIAYARTQTKS GSLKKD
Protein Names:Recommended name: UPF0397 protein SGO_0469
Gene Names:Ordered Locus Names:SGO_0469
Expression Region:1-186
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.