ELISA Recombinant Serratia proteamaculans Probable intracellular septation protein A (Spro_2677)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Serratia proteamacµLans (strain 568) Uniprot NO.:A8GF88 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQFLDFLPLIVFFAFYKLYDIYVASGALIVATALALVFTWFKYRKIEKMTLITFLMVLV FGTLTLVFHNDLFIKWKVTIIYTLFALALLISQLVLKKPLVQRmLGKELTLPDKVWNSLN LAWAVFFLVCGLANIYVAFWLPQSVWVNFKVFGLTALTLVFTLLSGVYIYRHMPEEQKK Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:Spro_2677 Expression Region:1-179 Sequence Info:fµLl length protein