ELISA Recombinant Shewanella pealeana Na(+)-translocating NADH-quinone reductase subunit D

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) Uniprot NO.:A8H779 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MADAKELKQVLIGPIVSNNPIALQILGVCSALAVTSKMETALVMTIALTAVCALSNLFIS LIRNHIPSSVRIIVQMTIIASLVIVVDQVLQAYAYDVAKQLSVFVGLIITNCIVMGRAEA YAMKTPPMMSFMDGIGNGLGYGAILLSVGFVRELFGNGSLFGIEILSKISDGGWYQPNGL LLLPPSAFFLIGALIWIIRVMKPEQVEAKG Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit D Short name= Na(+)-NQR subunit D Short name= Na(+)-translocating NQR subunit D EC= 1.6.5.- Alternative name(s): NQR complex subunit D NQR-1 subunit D Gene Names:Name:nqrD Ordered Locus Names:Spea_3100 Expression Region:1-210 Sequence Info:fµLl length protein