ELISA Recombinant Serratia proteamaculans UPF0059 membrane protein Spro_2817 (Spro_2817)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Serratia proteamacµLans (strain 568) Uniprot NO.:A8GFM8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLSATLILAFGMSMDAFAASIGKGASLHQPRFREALRTGLIFGVVEAITPIIGWGIGLF ASQYIMEWDHWVAFSLLFILGMRMIVEGVRNRPDEVEKVKRHGFWLLVATAIATSLDAMA IGVGLAFLQVNIVHTAMAIGCATMIMATLGMMIGRFIGPLLGKRAEILGGVVLIGIGVNI LLEHLGYLA Protein Names:Recommended name: UPF0059 membrane protein Spro_2817 Gene Names:Ordered Locus Names:Spro_2817 Expression Region:1-189 Sequence Info:fµLl length protein