ELISA Recombinant Rickettsia canadensis Prolipoprotein diacylglyceryl transferase(lgt)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rickettsia canadensis (strain McKiel) Uniprot NO.:A8EXB4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIFPNINPVIFSIGPFAISWYSLSYVIGILLGWFYANKIIEKFKPQITKKNLEDFITYAV IGIIVGGRLGFVLLYNPSRYFSNPIDILKTYQGGMSFHGGALGVIIAAYLFCRKYKVNFL SLTDIIATVVPIGLFLGRIANFINGELYGRITNSSFGIIFPNSDLSPRHPSQLYEAFFEG LVLFCILAYATFKHKTLEKRALNLGLFLTFYALFRITIEIFREPDMQIGFILDSLTMGQI LSIPmLILGSSLICQSTLK Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.- Gene Names:Name:lgt Ordered Locus Names:A1E_00220 Expression Region:1-259 Sequence Info:fµLl length protein